INTRODUZIONE
Le biotecnologie rappresentano una delle frontiere più
promettenti della scienza contemporanea, in grado di fornire
all’umanità nuove opportunità per combattere le malattie e per
allargare gli orizzonti della nostra conoscenza dei sistemi viventi.
La sperimentazione biotecnologica a livello cellulare sta
diventando imprescindibile per lo studio del differenziamento
cellulare e la morfogenesi, il controllo dell’espressione genica, la
biologia cellulare del cancro, la determinazione delle predisposizioni
genetiche per le malattie, le basi molecolari dell’attività dei farmaci, le
modificazioni genetiche di animali e piante.
Per prodotti biotecnologici si intendono proteine prodotte con
la tecnologia del DNA ricombinante e dell’ingegneria genetica in
sistemi cellulari in vitro.
Negli
anni
‘80
e
‘90
con
il
raggiungimento
del
sequenzionamento completo del genoma di molti organismi, fino a
quello recente del genoma umano, la possibilità di produrre in vitro
proteine purificate è diventata praticamente illimitata.
In generale i prodotti che fino ad ora hanno raggiunto l’utilizzo
clinico sono state proteine nella configurazione nativa, cioè
corrispondente al gene umano normale intatto.
Oggi, invece, vengono utilizzate delle proteine chimeriche, ovvero
molecole composte da porzioni codificate da geni umani e porzioni
1
codificate da geni di altre specie; per queste proteine, l’enorme
allargamento delle conoscenze sulle strutture tridimensionali, con la
identificazione dei domini strutturali, è stato decisivo per la
ingegnerizzazione di nuovi prodotti : esempio sono gli anticorpi
monoclonali chimerici.
RUOLO DEL TNF NELLE MALATTIE
AUOIMMUNI
Prima di prendere in esame lo sviluppo e la funzione degli
anticorpi monoclonali chimerici e non, ed in particolare dei farmaci
anti-TNF, bisogna descrivere il ruolo del TNF (tumor necrosis factor)
e di altre citochine in molte malattie autoimmuni disabilitanti.
L’estesa ricerca preclinica, nelle malattie autoimmuni, si è
focalizzata sulla regolazione dell’espressione delle citochine con
particolare
interesse
all’artrite
reumatoide,
e
questo
sforzo
multidisciplinare ha contribuito a spiegare i ruoli delle citochine in
questa ed in altre malattie autoimmuni [1].
Il TNF-α (fig.1) è emerso da questi studi come un
importantissimo regolatore dell’espressione di altre citochine pro-
2
infiammatorie come l’interleuchina-1 e l’interleuchina-6, diventando
così un bersaglio chiave per l’intervento terapeutico (fig.1).
Figura 1. Struttura del TNF-α.
Il
TNF-α
è
una
citochina
proinfiammatoria
e
immunoregolatoria che svolge numerosi effetti sistemici.
Sebbene il TNF sia espresso principalmente dai macrofagi,
viene anche prodotto da altre cellule, come linfociti, monociti,
cheratinociti, fibroblasti, i quali svolgono ruoli importanti nei vari
disordini reumatologici.
I recettori per il TNF (fig.2) sono situati su tutti i tipi di cellule.
Sono stati identificati due diversi recettori di superficie per il TNF-α
detti rispettivamente TNF-R1 o p-55 e TNF-R2 o p-75. Il primo è
coinvolto nella maggior parte degli effetti proinfiammatori e
citotossici del TNF-α, mentre il secondo sembra svolgere un ruolo
maggiore nelle risposte proliferative.
3
Figura 2. Recettori per il TNF.
Il TNF-α induce varie azioni proinfiammatorie nelle cellule
endoteliali, tra cui la produzione di citochine, l’espressione di
molecole di adesione, la liberazione di sostanze procoagulatorie e
l’induzione di sintetasi dell'ossido nitrico (NOS).
Queste alterazioni possono scatenare lo shock settico. Inoltre, il
TNF-α stimola i linfociti B e T, induce febbre, sopprime la lipasi
lipoproteica negli adipociti e stimola gli epatociti a produrre proteine
di fase acuta. Il TNF-α non è presente, a livello ematico, in individui
sani [2].
Una sovrapproduzione di TNF conduce ad alcune malattie
associate all’infiammazione, tra cui la sindrome di Behçet, il morbo di
Crohn e tante altre. Tutto ciò ha portato allo sviluppo di diversi
4
farmaci, chiamati anti-TNF-α che contrastano i differenti stadi della
produzione e secrezione del TNF-α.
La sintesi di TNF può essere inibita da inibitori della
fosfodiesterasi, prostanoidi, adenosina, corticosteroidi, interleuchina 10 e da specifici inibitori della metalloproteasi [3].
5
SVILUPPO DELLA TERAPIA CON ANTI-TNF
Come gia detto, l’eccessivo blocco dei TNF può essere utile
terapeuticamente per i suoi effetti a cascata sulle citochine proinfiammatorie.
Il primo passo logico nello sviluppo di farmaci proteici capaci
di neutralizzare i TNF, è emerso dalla ricerca preclinica. Si è infatti
visto che gli anticorpi monoclonali dei criceti diretti al TNF murino
erano in grado di ridurre l’infiammazione e il danno alle giunture nei
modelli di artrite di animali, riconoscendo definitivamente la validità
dell’approccio con farmaci anti-TNF nelle malattie autoimmuni.
Tuttavia, gli anticorpi monoclonali murini hanno diversi limiti
terapeutici dovuti alla loro alta immunogenicità, infatti solo anticorpi
chimerici o completamente umani hanno ottenuto l’approvazione per
la terapia di malattie croniche autoimmuni [4].
L'immunogenicità degli anticorpi rimane una delle limitazioni
associate alla somministrazione di anticorpi monoclonali murini a
soggetti umani. Nella maggior parte dei casi una singola iniezione di
anticorpi monoclonali murini provocherà una risposta immunitaria nel
50-80% dei pazienti, e generalmente si rivela la presenza di anticorpi
umani anti murini (HAMA) entro 14 giorni dalla somministrazione, e
ripetute somministrazioni (per esempio a scopo terapeutico)
aumenteranno significativamente la risposta, anche in quegli individui
6
che erano stati insensibili alla prima dose. La risposta immunitaria
provocherà la distruzione immediata delle seguenti dosi di anticorpi
somministrate.
In pratica, quindi, l'efficacia terapeutica degli anticorpi
monoclonali murini viene limitata alla prima o, al massimo, alla
seconda dose somministrata.
La tecnologia del DNA ricombinante ha fornito un alternativo e
riuscito metodo per ridurre l’immunogenicità innata degli anticorpi
monoclonali murini. Sono stati clonati i geni di tutti i sottotipi di
immunoglobuline umane, e questo ha permesso la produzione di vari
anticorpi ibridi ad immunogenicità ridotta.
Il primo metodo impiegato per ridurre l'antigenicità di un
anticorpo
monoclonale
murino
è
consistito
nel
costruire
semplicemente dei geni “chimerici” che codificavano proteine in cui
le regioni variabili degli anticorpi murini erano fuse con le regioni
costanti di un anticorpo umano: l’anticorpo chimerico conservava la
specificità di legame ma assomigliava maggiormente a un anticorpo
umano naturale.
Da questi lavori di biotecnologia sono nati due farmaci come
l’Infliximab (Remicade) e l’Adalimumab (Humira) che rappresentano
una importante linea di farmaci biologici anti-TNF con applicazione
clinica.
Contemporaneamente allo sviluppo degli anticorpi monoclonali
in terapia, forme solubili di recettore TNF (TNF-Rs) sono state isolate
dall’urina umana. Questi recettori troncati sono in grado di legare
7
TNF-α e TNF-β e possono regolare l’attività biologica di queste
citochine. L’esistenza di TNF-Rs nei fluidi di pazienti con artrite
reumatoide ha mostrato un modo alternativo di esplorare i farmaci
proteici come regolatori dell’attività del TNF in vivo [5].
La scoperta delle funzioni dei recettori solubili dimerici TNF è
stata un’altra importante linea di sviluppo e rappresenta un ottimo
modo di controllo delle citochine.
Il prodotto terapeutico finale di questa ricerca è l’etanercept
(Embrel), un recettore solubile del TNF con applicazione clinica in
diversi disordini autoimmuni.
Entrambi i tipi di anti-TNF biologici (fig.3), i recettori solubili
dimerici e gli anticorpi monoclonali sono stati sviluppati per mezzo
della biologia molecolare e i farmaci proteici tesi al TNF
rappresentano oggi uno dei passi più importanti nel campo delle
biotecnologie farmaceutiche [5].
Figura 3. Rappresentazione schematica di Infliximab, Adalimumab e Etanercept.
8
RECETTORI DIMERICI SOLUBILI
L’uso di questi recettori in terapia fu postulato all’inizio degli
anni novanta ed è stato seguito con successo da ricercatori
dell’Immunex. Questi ricercatori sono stati in grado di clonare ed
esprimere geni che codificano recettori umani e murini usando la
tecnica di ricombinazione del DNA [6], ottenendo un gran numero di
proteine ricombinanti.
I recettori monomeri umani per i TNF sono stati i prodotti
iniziali sviluppati come farmaci, ma fu presto evidente la mancanza di
legame alle citochine.
Si sviluppò in seguito la dimerizzazione del recettore solubile
che portò ad un grande aumento nell’affinità di legame e nell’attività
biologica. L’omodimero fu costruito impiegando tecniche di biologia
molecolare per costruire un gene chimerico: la porzione extracellulare
legante il TNF del p-75 è stato collegato al DNA che codifica i domini
delle IgG umane [7]. Il clone ottenuto, consistente in sequenze
totalmente umane, fu introdotto nelle cellule di mammifero per
esprimere la proteina di fusione chimerica TNFR-Fc. Questa proteina
che, dopo la traslazione, è ancora monomerica, forma ponti di solfuro
tra le porzioni di cisteina del segmento Fc, producendo il recettore
solubile dimerico attivo che è secreto nei mezzi di coltura.
9
Il recettore solubile chimerico lega con alta affinità due
molecole TNF, sequestrando così la citochina nei fluidi biologici.
Ha eccellente attività in vivo e la presenza della porzione di Fc
permette, oltre alla dimerizzazione, una più lunga emivita plasmatica
alla proteina [7].
SVILUPPO DI PROTEINE RICOMBINANTI
La produzione biotecnologica di proteine ricombinanti include diversi
stadi quali:
A) Clonazione iniziale del gene che codifica la proteina
desiderata in un plasmide.
B) Successiva inserzione del vettore di espressione in una
cellula adatta per ottenere un sistema specifico di
espressione del vettore ospite. Le cellule ospiti possono
essere procarioti o eucarioti a seconda del risultato che si
vuole ottenere. La produzione della proteina terapeutica
attiva in cellule di mammifero è minore rispetto ad E.Coli
ma ha vantaggi di tipo funzionale. Le cellule ospiti useranno
i loro meccanismi di traduzione e trascrizione per esprimere
10
discrete quantità di proteine ricombinanti clonate. Dopo lo
sviluppo del processo per ottimizzare il prodotto e la qualità,
la proteina viene
C) ottenuta tramite fermentazione su larga scala o per processi
di colture di cellule.
D) Il punto finale è la purificazione e il controllo della qualità
della proteina ricombinante [8].
ETANERCEPT
La produzione di etanercept segue lo schema visto sopra ma
il passo A) ha richiesto il disegno preliminare di una strategia di
clonazione per costruire il gene chimerico codificando la proteina
ricombinante di fusione umana rhu TNFR-Fc in seguito chiamato
etanercept.
Questo fu fatto su differenti geni umani, tra cui ad esempio la
sequenza che lega il TNF del recettore p-75 e la porzione Fc dell’IgG1 umana.
Il gene per il TNF-R2 fu derivato da un insieme di c-DNA di
cellule fibroblaste umane clonate nel vettore di espressione eucariotico
p-CAV/NOT-TNFR,usato come fonte per la sequenza di DNA della
regione extracellulare del nativo TNF-R. Un frammento del p-
11
CAV/NOT-TNFR contenente la sequenza che codifica l’intera regione
extracellulare del TNF-R, fu legato con un secondo frammento di
restrizione del plasmide p-IXY498. L’ultima sequenza codifica per gli
amminoacidi della porzione Fc dell’IgG1 umana, il dominio che
costituirà la cornice di dimerizzazione nella costruzione finale della
proteina (fig.4) [9].
Figura 4. Struttura dell’Etanercept.
12
ANTICORPI MONOCLONALI: DISEGNO E
PRODUZIONE
Gli anticorpi monoclonali (Mabs) murini derivano da cellule
ibride (ibridomi) generati dall’immunizzazione di un animale con un
antigene bersaglio, unendo poi le cellule B produttrici dell’anticorpo
con le cellule tumorali di un topo . Le cellule ottenute (ibridoma) si
possono coltivare facilmente per produrre anticorpi monoclonali,
poichè esse combinano le proprietà di crescita tipiche delle cellule
tumorali con la specificità di produzione di anticorpi della cellula B
originaria[10].
Gli anticorpi chimerici sono costituiti da una regione costante
umana (C) ed una parte di regione variabile (V) non umana, poiché le
regioni variabili contengono i domini che legano l’antigene, sufficienti
a determinare la specificità dell’anticorpo (fig.5).
Figura 5. Rappresentazione schematica dell’Infliximab.
13
Gli anticorpi chimerici mantengono infatti l’alta affinità e
la capacità neutralizzante dell’anticorpo non umano originario,
migliorando inoltre parecchie caratteristiche della proteina, come ad
esempio l‘emivita plasmatica e la risposta immunogenica nelle
applicazioni terapeutiche [11].
INFLIXIMAB
I metodi per la produzione biotecnologica dei Mabs chimerici
sono ben conosciuti e si affidano alla tecnologia dell’ibridoma
accoppiata alle tecniche di ingegneria genetica.
L’anticorpo chimerico A2 anti-TNF o Infliximab fu sviluppato
legando i geni delle regioni costanti dell’IgG1 con quelle dell’antigene
legante varie regioni clonate da un Mab murino anti-TNFα.
L’ibridoma originale anti-TNFα murino fu originato tramite
immunizzazione di topi BALB/C con TNFα umano.
L’anticorpo chimerico A2 anti -TNF permise l’isolamento dei
geni che codificano i domini che legano l’antigene dell’anticorpo
murinico, cioè le regioni variabili della catena pesante (Vh) e leggera
(Vl). Questi segmenti di DNA furono uniti al DNA che codifica per le
regioni costanti umane pesanti (Ch) e leggere (Cl) per produrre geni
che codificano le immunoglobuline chimeriche [12].
14
Ciò fu fatto impiegando vettori di espressione per il plasmide
trasportando sequenza di catena umana Ch e Cl funzionalmente
complete, costruite per permettere il facile inserimento di qualsiasi
segmento di catena Vh o Vl (fig.6).
> Mouse-Human chimeric chain 1 Anti-TNF alpha VH
QIQLVQSGPELKKPGETVKISCKASGYTFTHYGMNWVKQAPGKGLKWMGWINTYTGEPTY
ADDFKEHFAFSLETSASTVFLQINNLKNEDTATYFCARERGDAMDYWGQGTSVTVSSGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
> Mouse-Human chimeric chain 1 Anti-TNF alpha VL
SIVMTQTPKFLLVSAGDRVTITCTASQSVSNDVVWYQQKPGQSPKMLMYSAFNRYTGVPD
RFTGRGYGTDFTFTISSVQAEDLAVYFCQQDYNSPRTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
> Mouse-Human chimeric chain 2 Anti-TNF alpha VH
QIQLVQSGPELKKPGETVKISCKASGYTFTHYGMNWVKQAPGKGLKWMGWINTYTGEPTY
ADDFKEHFAFSLETSASTVFLQINNLKNEDTATYFCARERGDAMDYWGQGTSVTVSSGPS
VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS
VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
> Mouse-Human chimeric chain 2 Anti-TNF alpha VL
SIVMTQTPKFLLVSAGDRVTITCTASQSVSNDVVWYQQKPGQSPKMLMYSAFNRYTGVPD
RFTGRGYGTDFTFTISSVQAEDLAVYFCQQDYNSPRTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Figura 6. Sequenze amminoacidiche delle varie catene dell’Infliximab.
I due vettori di espressione che trasportano i geni della catena
chimerica leggera e pesante furono inseriti in cellule di mammifero.
La cellula recipiente usata è la SP2/0, una cellula mieloide che può
15
sintetizzare, assemblare e secernere immunoglobuline glicosilate
codificate dai geni transfetti. Queste cellule, dette transfected, si
coltivano in condizioni che permettono l’espressione dei geni
incorporati sia in coltura che nella cavità peritoneale di un topo, e le
catene di immunoglobuline prodotte si possono recuperare come
anticorpi intatti dalla coltura o dal fluido ascitico.
Le cellule SP2/0 transfette con l’infliximab furono usate per
creare la grande cell bank C168J e WBC per la produzione
dell’anticorpo ricombinante per mezzo di continue colture di cellule di
perfusione.
Dopo la filtrazione l’anticorpo è purificato e testato per
contaminazione microbica, ph e contenuto di endotossine. I differenti
passi nel processo di purificazione includono affinità e cromatografia
anionica.
La validità e la specificità dell’infliximab derivano dalla regione
variabile del Mab A2 murino originale [13].
ADALIMUMAB
Molti anticorpi chimerici causano tuttora eventi avversi e, in
alcuni pazienti, possono indurre una risposta mediata da HACA
(Human Anti Chimeric Antibodies). Una soluzione per ridurre
ulteriormente le risposte immunogeniche indotte da anticorpi
16
chimerici è rimuovere tutte le sequenze topo-derivate e quindi
sviluppare interamente gli anticorpi umani monoclonali.
I topi transgenici e le tecniche di “phage display” sono le
tecnologie chiave ampliamente usate per isolare tali anticorpi umani,
portando
all’approvazione
dell’adalimumab,
un
anticorpo
monoclonale ricombinante diretto al TNF–α umano, il primo
anticorpo umano ad essere approvato.
L’adalimumab fu sviluppato da Knoll e Abbott e fabbricato da
Abbott con il nome commerciale di Humira.
L’adalimumab è espresso nelle cellule ovariche di criceti cinesi,
si lega specificatamente al TNF-α neutralizzando la sua funzione
biologica bloccando l’interazione con i recettori p-55 e p-75 per il
TNF.
L’adalimumab è considerato interamente umano nel senso che
le sequenze di gene codificante non contengono elementi clonati da
altre specie animali.
L’adalimumab (fig.7) è stato ottenuto con la metodologia di
“phage display” una potente tecnica per legare genotipi e fenotipi,
impiegata per selezionare i polipeptidi con nuove funzioni. Nella
“phage display”, frammenti di DNA che codificano combinazioni di
polipetidi si fondono in frammenti per geni specifici delle proteine di
membrana di batteriofagi, così che i geni di fusione siano visualizzati
sulla superficie dei batteriofagi stessi.
17
Figura 7. Struttura schematica dell’Adalimumab
.
Gli elementi con specificità di legame possono essere isolati in
vitro legandoli ad un recettore immobile, un processo chiamato
“panning”.
Il passaggio finale è determinare la sequenza di polipeptidi ad
alta affinità, chiudendo così l’anello genotipo-fenotipo.
L’adalimumab
fu
isolato
da
studiosi
dell’istituto
di
biotecnologie dell’Università di Cambridge come D2E7 attraverso
selezione guidata su “phage display”, usando l’anticorpo monoclonale
murino MAK-195 come stampo.
18
L’adalimumab è purificato attraverso vari passaggi di
cromatografia ed è soggetto a trattamento a basso ph e a filtrazione per
l’inattivazione e la rimozione del virus [14].
CONCLUSIONI
Nonostante i grandi passi in avanti che sono stati fatti negli
ultimi anni, ancora parecchie sfide preoccupano pazienti, medici e
industrie biotecnologiche, tra cui l’immunogenicità e gli alti costi di
questi farmaci.
Anni di studi e sviluppo tecnologico di queste molecole hanno
portato grandi vantaggi, soprattutto con l’avvento dell’umanizzazione
delle proteine ricombinanti e i Mabs, ma ciò nonostante queste
proteine possono stimolare ancora la produzione di anticorpi
neutralizzanti specifici con una possibile riduzione dell’efficacia del
farmaco.
La presenza di anticorpi anti-etanercept non è comune ma è
stata evidenziata in pazienti con artrite reumatoide e psoriasi,
specialmente in monoterapia.
E’ stata rilevata anche la presenza di anticorpi anti- adalimumab
con risultati che variano a seconda della dose, della frequenza di
19
somministrazione
e
della
somministrazione
concomitante
di
Metotrexato [15, 16].
Sono stati trovati anche degli anticorpi dell’infliximab in
pazienti con artrite reumatoide o con il morbo di Crohn ed è stata
evidenziata un’associazione tra anticorpi dell’infliximab e la riduzione
dell’efficacia del farmaco stesso.
In questo momento non sembra sia possibile una risoluzione di
questo problema in breve tempo, ma le aziende di biotecnologia
farmaceutica stanno lavorando sotto tantissimi aspetti.
L’altro problema da affrontare per lo sviluppo e la diffusione di
questi farmaci è il loro altissimo costo, ma, poiché i farmaci
biotecnologici sono parte del nostro futuro, si sta lavorando tantissimo
anche in questo senso.
La competizione può anche giocare un ruolo importante: le
prime aziende bio-farmaceutiche hanno gia iniziato a rilasciare i
brevetti ed infatti l’Agenzia Europea del Farmaco ha gia approvato le
linee guida per lo sviluppo e l’approvazione di biofarmaci generici
[17].
Nonostante queste sfide, i farmaci biotecnologici sono una
realtà i cui benefici sono sotto gli occhi di tutti, ma c’è ancora molto
da lavorare per fornire ai pazienti medicinali sicuri, efficaci ed anche
economici.
20
BIBLIOGRAFIA
[1] Feldmann M. Pathogenesis of arthritis: recent research progress.
Nat Immunol 2001; 2: 771-773.
[2] Stokes D.G. and Kremer J.M. Potential of tumor necrosis factor
neutralization strategies in the rheumatologic disorders other then
rheumatoid arthritis. Seminars in the arthritis and rheumatism
2003;33:1-18.
[3] Feldmann M. and Maini R.N. Anti-TNF alpha therapy of
rheumatoidarthritis:
what
have
we
learned?
Annual
Revue
Immunology 2001; 19:163-196.
[4] Engelmann H, Novick D. and Wallach D. Two tumor necrosis
factor-binding proteins purified from human urine. Evidence for
immunological cross-reactivity with cell surface tumor necrosis factor
receptors. J Biol Chem 1990; 265: 1531-1536.
[5] Maggon K. Best-selling human medicines 2002-2004. Drug
Discov Today 2005; 10: 739-742.
[6] Mount C. and Featherstone J. Rheumatoid arthritis market. Nat
Rev Drug Discov 2005; 4: 11-12.
[7] Feldmann M. Development of anti-TNF therapy for rheumatoid
arthritis. Nat Rev Immunol 2002; 2: 364-371.
[8] Jacobs C. and Smith C; Immunex Corp, assignee. Methods of
lowering active TNF-alpha in mammals using tumor necrosis factor
receptor. US patent 5,606,690. 1997.
21
[9] Goldenberg MM. Etanercept, a novel drug for the treatment of
patients with severe, active rheumatoid arthritis. Clin Ther 1999; 21:
75-87.
[10] Kohler G. and Milstein C. Continuous cultures of fused cells
secreting antibody of predefined specificity. Nature 1975; 256: 495497.
[11] Harlow E.and Lane D. Antibodies : a laboratory manual. Cold
Spring Harbor: Cold Spring Harbor Laboratory Press; 1988.
[12] Knight DM, Trinh H, Le J, Siegel S, Shealy D, McDonough M,
Scallon B, Moore MA, Vilcek J, Daddona P, et al. Construction and
initial characterization of a mouse- human chimeric anti-TNF
antibody. Mol Immunol 1993; 30: 1443-1453.
[13] Brekke O.H. and Sandlie I. Therapeutic antibodies for human
diseases at the dawn of the twenty-first century. Nat Rev Drug Discov.
2003; 2: 52-62.
[14] Bain B. and Brazil M. Adalimumab. Nat. Rev. Drug Discov.
2003; 2 : 693-694.
[15] Genovese MC, Bathon J.M, Martin RW, Fleischmann RM,
Tesser JR, Schiff MH, Keystone EC, Wasko MC, Moreland LW,
Weaver AL, Markenson J, Cannon GW, Spencer-Green G. and Finck
BK. Etanercept versus methotrexate in patients with early rheumatoid
arthritis: two-year radiographic and clinical outcomes. Arthritis
Rheum 2002; 46: 1443-1450.
22
[16] Leonardi CL, Powers JL, Matheson RT, Goffe BS, Zitnik R,
Wang A and Gottlieb AB. The Etanercept Psoriasis Study Group.
Etanercept as Monotherapy in Patients with Psoriasis. N Engl J Med
2003; 349: 2014-2022.
[17] Committee for medicinal products for human use(CHMP) EMEA. Guideline on similar biological medicinal products.
http://www.emea.eu.int; 2005.
23
Scarica

Farmaci biologici anti-TNF nelle malattie autoimmuni